Medizinische Universität Graz Austria/Österreich - Forschungsportal - Medical University of Graz

Logo MUG-Forschungsportal

Gewählte Publikation:

SHR Neuro Krebs Kardio Lipid Stoffw Microb

Staropoli, M; Schwaiger, T; Tuzlak, J; Biba, R; Petrowitsch, L; Fessler, J; Roje, M; Cammarata, M; Malanović, N; Jakas, A.
Truncated Equinin B Variants Reveal the Sequence Determinants of Antimicrobial Selectivity.
Mar Drugs. 2026; 24(1): Doi: 10.3390/md24010046 [OPEN ACCESS]
PubMed PUBMED Central FullText FullText_MUG

 

Autor*innen der Med Uni Graz:
Fessler Johannes
Altmetrics:

Dimensions Citations:

Plum Analytics:

Scite (citation analytics):

Abstract:
Equinin B (GQCQRKCLGHCSKKCPKHPQCRKRCIRRCFGYCL), a marine peptide from Actinia equina exhibits antibacterial activity against both Gram-positive and Gram-negative bacteria. To identify a smaller active region and explore tunable properties, three peptide fragments were synthesized: GQCQRKCLGHCS (EB1), KKCPKHPQCRK (EB2), and RCIRRCFGYCL (EB3), yielding peptides with key AMP-like properties, including the most positively charged and most hydrophobic regions. Only the 11-residue C-terminal fragment showed selective activity against Gram-positive bacteria, including Staphylococcus epidermidis, Bacillus subtilis, and Enterococcus hirae, while remaining inactive against Escherichia coli. Peptide modifications, achieved by replacing cysteine residues with arginine, generally did not enhance activity, but in the C-terminal fragment EB3 they reduced hemolytic activity and increased bacterial specificity. Membrane depolarization assays confirmed that the unmodified fragment EB3 strongly compromises bacterial membranes, whereas the modified variant showed minimal depolarization, highlighting its markedly reduced membrane-perturbing potential. In silico modelling revealed that the EB3 can adopt multiple membrane-disruption modes, from transient shallow pores to carpet-like mechanisms, while the cysteine-to-arginine variant interacts mainly via partial insertion anchored by arginine residues. Phenylalanine appears to interact with the membrane, and reducing hydrophobicity by its removal abolished antibacterial activity. These findings highlight the 11-residue C-terminal fragment as a tunable, membrane-targeting motif with mechanistic novelty, offering a blueprint for developing safer, selective antimicrobial peptides with reduced cytotoxicity.
Find related publications in this database (using NLM MeSH Indexing)
Anti-Bacterial Agents - pharmacology, chemistry
Gram-Positive Bacteria - drug effects
Microbial Sensitivity Tests - administration & dosage
Gram-Negative Bacteria - drug effects
Amino Acid Sequence - administration & dosage
Antimicrobial Peptides - pharmacology, chemistry
Humans - administration & dosage
Animals - administration & dosage

© Med Uni Graz • Impressum